ZNF395 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF395 Polyclonal antibody, PBS Only (11759-1-PBS)

• 

  WB analysis of human brain using 11759-1-AP (same clone as 11759-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 11759-1-AP (ZNF395 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11759-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 11759-1-AP (same clone as 11759-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11759-1-AP (ZNF395 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11759-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11759-1-AP (same clone as 11759-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11759-1-AP (ZNF395 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11759-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11759-1-AP (same clone as 11759-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11759-1-AP (ZNF395 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11759-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11759-1-AP (same clone as 11759-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using ZNF395 antibody (11759-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11759-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZNF395 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11759-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HD-regulating factor 2, HDBP-2, HDBP2, HDBP 2, HD regulating factor 2

---

Product Information

11759-1-PBS targets ZNF395 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2355

  Product name: Recombinant human ZNF395 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 161-513 aa of BC001237

  Sequence: DAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDISDSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMYKCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPTSEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPVSPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVYGIEHRDQWCTACRWKKACQRFLD

• Full Name: zinc finger protein 395
• Calculated Molecular Weight: 513 aa, 55 kDa
• Observed Molecular Weight: 62 kDa, 72 kDa
• GenBank Accession Number: BC001237
• Gene Symbol: ZNF395
• Gene ID (NCBI): 55893
• RRID: AB_2218065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H8N7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF395 is a transcription factors binding to a 7bp GC rich sequence which resides in triplicate at intervals of 13bp within and proximal to the -20bp direct repeat sequences of the Htt promoter. It can bind to regulatory regions in papillomaviruses (PV) and subsequently called the protein papillomavirus binding factor (PBF) [PMID: 11853404]. It contains conserved regions CR1, CR2 and CR3, a domain rich in serines and prolines and have the potential to form a zinc-finger structure, and the C-terminal CR3 is responsible for DNA-binding [PMID: 17897615].