ZNF446 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF446 Polyclonal antibody, PBS Only (16218-1-PBS)

• 

  WB analysis of SH-SY5Y using 16218-1-AP (same clone as 16218-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 16218-1-AP (ZNF446 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16218-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 16218-1-AP (same clone as 16218-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 16218-1-AP (ZNF446 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16218-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 16218-1-AP (same clone as 16218-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed SH-SY5Y cells using 16218-1-AP (ZNF446 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16218-1-PBS in a different storage buffer formulation.

ZNF446 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16218-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16218-1-PBS targets ZNF446 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9266

  Product name: Recombinant human ZNF446 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-422 aa of BC017206

  Sequence: EQFLGTLPPEIQAWVRGQRPGSPEEAAALVEGLQHDPGQLLGWITAHVLKQEVLPAAQKTEEPLGSPHPSGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGHHGHQEPASTSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLGLPPHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEAQPPQGPGPAAWEGLSGAATPAPTVRPGTPPVPTQPTPAETRLEPAATPRKPYTCEQCGRGFDWKSVFVIHHRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRHSLTGPRSYPCEECGCSFSWKSQLVIHRKSHRPEVP

• Full Name: zinc finger protein 446
• Calculated Molecular Weight: 422 aa, 46 kDa
• Observed Molecular Weight: 49-55 kDa
• GenBank Accession Number: BC017206
• Gene Symbol: ZNF446
• Gene ID (NCBI): 55663
• RRID: AB_2878231
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWS9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.