ZNF449 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF449 Polyclonal antibody, PBS Only (32701-1-PBS)

• 

  IP experiment of HEK-293 using 32701-1-AP (same clone as 32701-1-PBS)

  IP result of anti-ZNF449 (IP:32701-1-AP, 4ug; Detection:32701-1-AP 1:600) with HEK-293 cells lysate 1280 ug. This data was developed using the same antibody clone with 32701-1-PBS in a different storage buffer formulation.

ZNF449 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 32701-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, Indirect ELISA

Synonyms

Zinc finger and SCAN domain-containing protein 19, Zinc finger protein 449, ZSCAN19

---

Product Information

32701-1-PBS targets ZNF449 in IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36778

  Product name: Recombinant human ZNF449 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-430 aa of BC060768

  Sequence: ENREEPWVKELQDSKEMKQLLDSKIGFEIGIENEEDTSKQKKMETMYPFIVTLEGNALQGPILQKDYVQLENQWETPPEDLQTDLAKLVDQQNPTLGETPENSNLEEPLNPKPHKKKSPGEKPHRCPQCGKCFARKSQLTGHQRIHSGEEPHKCPECGKRFLRSSDLYRHQRLHTGERPYECTVCKKRFTRRSHLIGHQRTHSEEETYKCLECGKSFCHGSSLKRHLKTHT

• Full Name: zinc finger protein 449
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC060768
• Gene Symbol: ZNF449
• Gene ID (NCBI): 203523
• RRID: AB_3742715
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6P9G9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF449 (Zinc Finger Protein 449) is a member of the zinc-finger family of transcription factors. It is encoded by a gene located on the X chromosome (Xq26.3) and contains an N-terminal SCAN domain and seven C2H2-type zinc finger motifs at the C-terminus.