ZNF462 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF462 Polyclonal antibody, PBS Only (23793-1-PBS)

• 

  WB analysis using 23793-1-AP (same clone as 23793-1-PBS)

  Mouse retina tissue lysates were subjected to SDS PAGE followed by western blot with 23793-1-AP (ZNF462 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23793-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse eye using 23793-1-AP (same clone as 23793-1-PBS)

  IP result of anti-ZNF462 (IP:23793-1-AP, 4ug; Detection:23793-1-AP 1:500) with mouse eye tissue lysate 3600 ug. This data was developed using the same antibody clone with 23793-1-PBS in a different storage buffer formulation.

ZNF462 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 23793-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

Zfp462, ZFPIP, Zinc finger PBX1-interacting protein

---

Product Information

23793-1-PBS targets ZNF462 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20699

  Product name: Recombinant human ZNF462 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2157-2506 aa of BC036884

  Sequence: NHYQSAALARNNSRVSPVPLSGAAAGTEQKTEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKCKDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHREERVVPIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELDSHLRDEHKVSRNFELVGRVNLDQLEQMKEKMESSSSDDEDKEEEMNSKAEDRELMRFSDHGAALNTEKRFPCEFCGRAFSQGSEWERHVLRHGMALNDTKQVSREEIHPKEIMENSVKMPSIEEKEDDEAIGIDFSLKNETVAICVVTADKSLLENAEAKKE

• Full Name: zinc finger protein 462
• Calculated Molecular Weight: 2506 aa, 285 kDa
• Observed Molecular Weight: 285 kDa
• GenBank Accession Number: BC036884
• Gene Symbol: ZNF462
• Gene ID (NCBI): 58499
• RRID: AB_3742090
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96JM2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF462 (Zinc Finger Protein 462) is a C2H2 type zinc finger transcription factor of unknown function . Although the specific function of this molecule is unknown, animal studies have shown that it plays a vital role in embryonic development.(PMID: 31361404, PMID: 39069253)