ZNF557 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF557 Polyclonal antibody, PBS Only (20500-1-PBS)

• 

  WB analysis of HepG2 using 20500-1-AP (same clone as 20500-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 20500-1-AP (ZNF557 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20500-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 20500-1-AP (same clone as 20500-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 20500-1-AP (ZNF557 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20500-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 20500-1-AP (same clone as 20500-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 20500-1-AP (ZNF557 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 20500-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 20500-1-AP (same clone as 20500-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 20500-1-AP (ZNF557 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 20500-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 20500-1-AP (same clone as 20500-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 20500-1-AP (ZNF557 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20500-1-PBS in a different storage buffer formulation.

ZNF557 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 20500-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20500-1-PBS targets ZNF557 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14239

  Product name: Recombinant human ZNF557 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 76-376 aa of BC003020

  Sequence: CRNLASLGNQVDKPRLISQLEQEDKVMTEERGILSGTCPDVENPFKAKGLTPKLHVFRKEQSRNMKMERNHLGATLNECNQCFKVFSTKSSLTRHRKIHTGERPYGCSECGKSYSSRSYLAVHKRIHNGEKPYECNDCGKTFSSRSYLTVHKRIHNGEKPYECSDCGKTFSNSSYLRPHLRIHTGEKPYKCNQCFREFRTQSIFTRHKRVHTGEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQHIRTHTGEKPYTCNECGKSFTNSFSLTIHRRIHNGEKS

• Full Name: zinc finger protein 557
• Calculated Molecular Weight: 423 aa, 49 kDa
• Observed Molecular Weight: 49 kDa
• GenBank Accession Number: BC003020
• Gene Symbol: ZNF557
• Gene ID (NCBI): 79230
• RRID: AB_2878695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N988
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.