ZNF573 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF573 Polyclonal antibody, PBS Only (24755-1-PBS)

• 

  IHC staining of human liver using 24755-1-AP (same clone as 24755-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24755-1-AP (ZNF573 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24755-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 24755-1-AP (same clone as 24755-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24755-1-AP (ZNF573 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24755-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24755-1-AP (same clone as 24755-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24755-1-AP (ZNF573 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24755-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24755-1-AP (same clone as 24755-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24755-1-AP (ZNF573 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24755-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 24755-1-AP (same clone as 24755-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using ZNF573 antibody (24755-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24755-1-PBS in a different storage buffer formulation.

ZNF573 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 24755-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24755-1-PBS targets ZNF573 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20475

  Product name: Recombinant human ZNF573 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 55-150 aa of BC042170

  Sequence: PVVVDLLERGKEPWMILREETQFTDLDLQCEIISYIEVPTYETDISSTQLQSIYKREKLYECKKCQKKFSSGYQLILHHRFHVIERPYECKECGKN

• Full Name: zinc finger protein 573
• Calculated Molecular Weight: 645 aa, 76 kDa
• GenBank Accession Number: BC042170
• Gene Symbol: ZNF573
• Gene ID (NCBI): 126231
• RRID: AB_3085753
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YE8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF573 belongs to the krueppel C2H2-type zinc-finger protein family. ZNF573 is involved in a broad range of biological functions including apoptosis, protein structure, DNA recognition, and RNA transcription, the structural variation in ZNF573 protein may result in the abnormal growth and development of human lens, further leading to the occurrence of cataracts.