ZNF580 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF580 Polyclonal antibody, PBS Only (25992-1-PBS)

• 

  IP experiment of COLO 320 using 25992-1-AP (same clone as 25992-1-PBS)

  IP result of anti-ZNF580 (IP:25992-1-AP, 4ug; Detection:25992-1-AP 1:800) with COLO 320 cells lysate 1320 ug. This data was developed using the same antibody clone with 25992-1-PBS in a different storage buffer formulation.

ZNF580 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 25992-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, Indirect ELISA

Synonyms

---

Product Information

25992-1-PBS targets ZNF580 in IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23313

  Product name: Recombinant human ZNF580 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-124 aa of BC017698

  Sequence: MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGA

• Full Name: zinc finger protein 580
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC017698
• Gene Symbol: ZNF580
• Gene ID (NCBI): 51157
• RRID: AB_3669515
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UK33
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF580 enables sequence-specific double-stranded DNA binding activity. Involved in several processes, including cellular response to hydrogen peroxide; positive regulation of cell migration; and positive regulation of interleukin-8 production.