ZNF664 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF664 Polyclonal antibody, PBS Only (29317-1-PBS)

• 

  IP experiment of mouse liver using 29317-1-AP (same clone as 29317-1-PBS)

  IP result of anti-ZNF664 (IP:29317-1-AP, 4ug; Detection:29317-1-AP 1:500) with mouse liver tissue lysate 2400 ug. This data was developed using the same antibody clone with 29317-1-PBS in a different storage buffer formulation.

ZNF664 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 29317-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, Indirect ELISA

Synonyms

ZFOC1, zinc finger protein 664

---

Product Information

29317-1-PBS targets ZNF664 in IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30992

  Product name: Recombinant human ZNF664 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-100 aa of BC101530

  Sequence: WRDHTGEKVYKCDDCGKDFSTTTKLNRHKKIHTVEKPYKCYECGKAFNWSS

• Full Name: zinc finger protein 664
• Calculated Molecular Weight: 261 aa, 30 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC101530
• Gene Symbol: ZNF664
• Gene ID (NCBI): 144348
• RRID: AB_3742309
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N3J9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF664 (Zinc Finger Protein 664) is a nuclear-localized protein that belongs to the Krueppel C2H2-type zinc-finger protein family. It contains nine tandem C2H2-type zinc finger motifs, a structural feature that enables sequence-specific DNA-binding and transcription factor activity.