ZNF683 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF683 Polyclonal antibody, PBS Only (32229-1-PBS)

• 

  WB analysis using 32229-1-AP (same clone as 32229-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32229-1-AP (ZNF683 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32229-1-PBS in a different storage buffer formulation.

ZNF683 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32229-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Zinc finger protein 683, Tissue-resident T-cell transcription regulator protein ZNF683, Homolog of Blimp-1 in T-cell, Hobit

---

Product Information

32229-1-PBS targets ZNF683 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37412

  Product name: Recombinant human ZNF683 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-296 aa of BC028731

  Sequence: MALGGTGGSLSPSLDFQLFRGDQVFSACRPLPDMVDAHGPSCASWLCPLPLAPGRSALLACLQDLDLNLCTPQPAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQPERAGEGAPCPAFSSHNSSSPPPLQNRKSPSPLAFCPCPPVNSISKELPFLLHAFYPGYPLLLPPPHLFTYGALPSDQCPHLLMLPQDPSYPTMAMPSLLMMVNELGHPSARWETLLPYPGAFQASGQALPSQARNPGAGAAPTDSPGLERGGMASPAKRVPLSSQTGTAALPY

• Full Name: zinc finger protein 683
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC028731
• Gene Symbol: ZNF683
• Gene ID (NCBI): 257101
• RRID: AB_3670226
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IZ20
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger protein 683 (ZNF683, also known as Hobit) is a transcription factor that mediates a transcriptional program in various innate and adaptive immune tissue-resident lymphocyte T-cell types such as tissue-resident memory T (Trm) and natural killer cells (PMID: 36869093; 28555134; 36245253). It probably is a cancer-specific Trms marker (PMID: 36869093).