ZNF695 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF695 Polyclonal antibody, PBS Only (25556-1-PBS)

• 

  WB analysis of HepG2 using 25556-1-AP (same clone as 25556-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25556-1-AP (ZNF695 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25556-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 25556-1-AP (same clone as 25556-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25556-1-AP (ZNF695 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25556-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 25556-1-AP (same clone as 25556-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25556-1-AP (ZNF695 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25556-1-PBS in a different storage buffer formulation.

ZNF695 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25556-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

SBZF3

---

Product Information

25556-1-PBS targets ZNF695 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22202

  Product name: Recombinant human ZNF695 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 88-133 aa of BC023527

  Sequence: LSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM

• Full Name: zinc finger protein 695
• Calculated Molecular Weight: 515 aa, 60 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC023527
• Gene Symbol: ZNF695
• Gene ID (NCBI): 57116
• RRID: AB_2880130
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IW36
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.