Product Information
25556-1-PBS targets ZNF695 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22202 Product name: Recombinant human ZNF695 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 88-133 aa of BC023527 Sequence: LSSYLTEDILPEQGLQVSFQKVMLRRYERCCLEKLRLRNDWEIVAM Predict reactive species |
| Full Name | zinc finger protein 695 |
| Calculated Molecular Weight | 515 aa, 60 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC023527 |
| Gene Symbol | ZNF695 |
| Gene ID (NCBI) | 57116 |
| RRID | AB_2880130 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8IW36 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ZNF695 is a KRAB-containing zinc finger transcription factor localized in the nucleus. It binds DNA and mediates transcriptional repression, and its dysregulation participates in tumor progression across multiple malignancies. Elevated ZNF695 promotes cancer cell proliferation, accelerates cell cycle and suppresses apoptosis by activating NEK2 and PI3K/Akt/mTOR pathways. It acts as a prognostic biomarker correlated with tumor immune infiltration in colorectal, cervical, breast and endometrial cancers. Its expression varies among tumor subtypes, associating with aggressive tumor phenotypes (PMID: 38441026; PMID: 40682845).
