ZNF703 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF703 Polyclonal antibody, PBS Only (21075-1-PBS)

• 

  WB analysis of Jurkat using 21075-1-AP (same clone as 21075-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21075-1-AP (ZNF703 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 21075-1-AP (same clone as 21075-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 21075-1-AP (ZNF703 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 21075-1-AP (same clone as 21075-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 21075-1-AP (ZNF703 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse intestine using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse intestine tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human malignant melanoma using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat skin using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat skin tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat small intestine using 21075-1-AP (same clone as 21075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 21075-1-AP (ZNF703 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21075-1-PBS in a different storage buffer formulation.

ZNF703 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21075-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ZPO1, ZNF503L, Zinc finger elbow-related proline domain protein 1, ZEPPO1

---

Product Information

21075-1-PBS targets ZNF703 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15242

  Product name: Recombinant human ZNF703 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 241-590 aa of BC032534

  Sequence: ELDKKDQEPKPSPEPAAVSRGGGGEPGAHGGAESGASGRKSEPPSALVGAGHVAPVSPYKPGHSVFPLPPSSIGYHGSIVGAYAGYPSQFVPGLDPSKSGLVGGQLSGGLGLPPGKPPSSSPLTGASPPSFLQGLCRDPYCLGGYHGASHLGGSSCSTCSAHDPAGPSLKAGGYPLVYPGHPLQPAALSSSAAQAALPGHPLYTYGFMLQNEPLPHSCNWVAASGPCDKRFATSEELLSHLRTHTALPGAEKLLAAYPGASGLGSAAAAAAAAASCHLHLPPPAAPGSPGSLSLRNPHTLGLSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ

• Full Name: zinc finger protein 703
• Calculated Molecular Weight: 590 aa, 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC032534
• Gene Symbol: ZNF703
• Gene ID (NCBI): 80139
• RRID: AB_10732687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7S9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.