Product Information
32274-1-PBS targets ZNF706 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37605 Product name: Recombinant human ZNF706 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC015925 Sequence: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA Predict reactive species |
| Full Name | zinc finger protein 706 |
| Calculated Molecular Weight | 76 aa, 8 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC015925 |
| Gene Symbol | ZNF706 |
| Gene ID (NCBI) | 51123 |
| RRID | AB_3742562 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9Y5V0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Zinc Finger domains account for 5% of all human proteins and interact with various substrates, such as lipids, DNA, RNA, and post-translational modifications. In addition, zinc finger proteins (ZNFs) are involved in transcriptional regulation, signal transduction, and other cellular processes. Zinc finger protein 706 (ZNF706), encoded by a gene located at chromosome 8q22.3, is a member of the C2H2-type zinc finger transcription factor family, the most abundant transcription factor family encoded by the human genome. And according to the structural analysis of ZNF706, it was definitely predicted to physically bind to DNA through the C-terminal zinc finger domain. In previous studies, it was reported that the expression of ZNF706 is upregulated in gastric cancer and laryngeal cancer. And ZNF706 may be a biomarker for the early diagnosis of rheumatoid arthritis. ZNF706 is a potential oncogene in liver cancer and functions as a ferroptosis regulator by modulating SLC7A11 expression, constituting a potential therapeutic target for HCC (PMID: 38862581).
