ZNF718 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF718 Polyclonal antibody, PBS Only (22074-1-PBS)

• 

  IF Staining of HeLa using 22074-1-AP (same clone as 22074-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZNF718 antibody (22074-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 22074-1-PBS in a different storage buffer formulation.

ZNF718 Polyclonal Antibody for IF/ICC, Indirect ELISA

Cat No. 22074-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

zinc finger protein 718

---

Product Information

22074-1-PBS targets ZNF718 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17216

  Product name: Recombinant human ZNF718 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 311-431 aa of BC104027

  Sequence: FSCEECGNVFTTSSDFAKHKRIHTGEKPYKCEECGKSFNRSTTLTTHKRIHTGEKPYTCEECGKAFNWSSTLNVHKRIHSGKNPYKCEDCGKAFKVFANLHNHKKIHTGEKPYICKQCGKA

• Full Name: zinc finger protein 718
• Calculated Molecular Weight: 478 aa, 55 kDa
• GenBank Accession Number: BC104027
• Gene Symbol: ZNF718
• Gene ID (NCBI): 255403
• RRID: AB_3742065
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3SXZ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF718 (Zinc Finger Protein 718) is a member of the Krueppel C2H2-type zinc‑finger protein family, a large class of transcription factors characterized by tandem C2H2 zinc‑finger motifs that mediate sequence‑specific DNA binding.