ZNF787 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF787 Polyclonal antibody, PBS Only (31934-1-PBS)

• 

  WB analysis using 31934-1-AP (same clone as 31934-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31934-1-AP (ZNF787 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31934-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 31934-1-AP (same clone as 31934-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ZNF787 antibody (31934-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 31934-1-PBS in a different storage buffer formulation.

ZNF787 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 31934-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

31934-1-PBS targets ZNF787 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36052

  Product name: Recombinant human ZNF787 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-50 aa of BC077728

  Sequence: MELREEAWSPGPLDSEDQQMASHENPVDILIMDDDDVPSWPPTKLSPPQS

• Full Name: zinc finger protein 787
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC077728
• Gene Symbol: ZNF787
• Gene ID (NCBI): 126208
• RRID: AB_3670151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6DD87
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger protein 787 (ZNF787, also known as TIP20) is activated in the nucleus and may be involved in transcriptional regulation. It probably is one repressor of neuronal features and can interact with histone deacetylase 1 (HDAC1) in regulating the permeability of the blood-brain barrier (BBB) as well as the pathogenesis of Alzheimer's disease (PMID: 33057419; 38329647).