Home
Products
Primary Antibodies
ZNF816 Polyclonal antibody, PBS Only (21221-1-PBS)

Filter: AllIHCIF/ICC

IHC staining of human ovary tumor using 21221-1-AP (same clone as 21221-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21221-1-AP (ZNF816A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21221-1-PBS in a different storage buffer formulation.
IHC staining of human ovary tumor using 21221-1-AP (same clone as 21221-1-PBS)
Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 21221-1-AP (ZNF816A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21221-1-PBS in a different storage buffer formulation.
IF Staining of U-251 using 21221-1-AP (same clone as 21221-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed U-251 cells using ZNF816A antibody (21221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21221-1-PBS in a different storage buffer formulation.
IF Staining of U-251 using 21221-1-AP (same clone as 21221-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using ZNF816A antibody (21221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21221-1-PBS in a different storage buffer formulation.
IF Staining of PC-3 using 21221-1-AP (same clone as 21221-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using ZNF816A antibody (21221-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 21221-1-PBS in a different storage buffer formulation.

ZNF816 Polyclonal antibody, PBS Only

Name: ZNF816 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 21221-1-PBS

ZNF816 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 21221-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

ZNF816A

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

21221-1-PBS targets ZNF816 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag15658 Product name: Recombinant human ZNF816A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 399-506 aa of BC105930 Sequence: CEECDNVYIRRSHLERHRKIHTGEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRSFSRKSSLQYHHTLHTGEKPYTCNECGKVFSRRENLARHHRLHAGE Predict reactive species
Full Name	zinc finger protein 816A
Calculated Molecular Weight	651 aa, 76 kDa
GenBank Accession Number	BC105930
Gene Symbol	ZNF816A
Gene ID (NCBI)	125893
RRID	AB_3742021
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q0VGE8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

ZNF816 ( Zinc finger protein 816), a direct target of ZBED4, was found to interact with multiple FDA-approved immunomodulatory agents, suggesting a potential ZBED4-ZNF816 regulatory axis with translational value.