ZNHIT1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNHIT1 Polyclonal antibody, PBS Only (16595-1-PBS)

• 

  WB analysis using 16595-1-AP (same clone as 16595-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16595-1-AP (ZNHIT1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16595-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 16595-1-AP (same clone as 16595-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16595-1-AP (ZNHIT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16595-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 16595-1-AP (same clone as 16595-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 16595-1-AP (ZNHIT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16595-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 16595-1-AP (same clone as 16595-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using ZNHIT1 antibody (16595-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16595-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 16595-1-AP (same clone as 16595-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using ZNHIT1 antibody (16595-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16595-1-PBS in a different storage buffer formulation.

ZNHIT1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16595-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16595-1-PBS targets ZNHIT1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9741

  Product name: Recombinant human ZNHIT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC017333

  Sequence: MVEKKTSVRSQDPGQRRVLDRAARQRRINRQLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRFRKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVSCGARYCTVRCLGTHQETRCLKWTV

• Full Name: zinc finger, HIT type 1
• Calculated Molecular Weight: 154 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC017333
• Gene Symbol: ZNHIT1
• Gene ID (NCBI): 10467
• RRID: AB_2220382
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43257
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNHIT1(Zinc finger HIT domain containing protein 1), aslo named CGBP1 (Cyclin G1 binding protein 1), is a subunit of the SNF-2 related CBP activator protein (SRCAP) complex, which can remodel chromatin by incorporating the histone variant H2A.Z into nucleosomes(PMID: 15647280). ZNHIT1 also can bind to myogenin promoter and mediate H2A.Z incorporation for its expression(PMID: 20473270). ZNHIT1 overexpression induces apoptosis and represses proliferation and invasion of breast cancer cells(PMID: 30928405).