ZNHIT6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNHIT6 Polyclonal antibody, PBS Only (28019-1-PBS)

• 

  WB analysis of mouse lung using 28019-1-AP (same clone as 28019-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 28019-1-AP (ZNHIT6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28019-1-PBS in a different storage buffer formulation.

ZNHIT6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 28019-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

28019-1-PBS targets ZNHIT6 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27792

  Product name: Recombinant human ZNHIT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-203 aa of BC026236

  Sequence: MEFAAENEGKSGGGLHSVAEGVRLSPEPGREGVRDLAGAEEFGGGEEGTGLTGIKEIGDGEEGSGQRPEEIPMDLTVVKQEIIDWPGTEGRLAGQWVEQEVEDRPEVKDENAGVLEVKQETDSSLVVKEAKVGEPEVKEEKVKEEVMDWSEVKEEKDNLEIKQEEKFVGQCIKEELMHGECVKEEKDFLKKEIVDDTKVKEEP

• Full Name: zinc finger, HIT type 6
• Calculated Molecular Weight: 470 aa, 54 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC026236
• Gene Symbol: ZNHIT6
• Gene ID (NCBI): 54680
• RRID: AB_2881037
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWK9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.