ZnT4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZnT4 Polyclonal antibody, PBS Only (12623-1-PBS)

• 

  WB analysis using 12623-1-AP (same clone as 12623-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 12623-1-AP (ZnT4 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12623-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12623-1-AP (same clone as 12623-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12623-1-AP (ZnT4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12623-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12623-1-AP (same clone as 12623-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12623-1-AP (ZnT4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12623-1-PBS in a different storage buffer formulation.

ZnT4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12623-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

SLC30A4, Probable proton-coupled zinc antiporter SLC30A4, ZnT 4, ZnT-4

---

Product Information

12623-1-PBS targets ZnT4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3313

  Product name: Recombinant human SLC30A4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC026089

  Sequence: MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPERPVNGAHPTLQADDDSLLDQDLPLTNSQLSLKVDSCDNCSKQREILKQRKVKARLTIAAVL

• Full Name: solute carrier family 30 (zinc transporter), member 4
• Calculated Molecular Weight: 429 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC026089
• Gene Symbol: ZNT4
• Gene ID (NCBI): 7782
• RRID: AB_3085398
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14863
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZnT4, also known as SLC30A4, belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family and SLC30A subfamily. ZnT4 transports Zn into the trans-Golgi apparatus for lactose synthesis, and across the apical cell membrane for efflux from MECs into milk. ZnT4 is expressed in numerous tissues and is enriched in the prostate. ZnT4 encodes a protein with a molecular weight of 47 kDa (PMID: 26538236).