Tested Applications
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse ovary tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21279-1-AP targets ZP3 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15791 Product name: Recombinant human ZP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC113949 Sequence: MVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAF Predict reactive species |
| Full Name | zona pellucida glycoprotein 3 (sperm receptor) |
| Calculated Molecular Weight | 373 aa, 41 kDa |
| Observed Molecular Weight | 47 kDa, 60 kDa |
| GenBank Accession Number | BC113949 |
| Gene Symbol | ZP3 |
| Gene ID (NCBI) | 7784 |
| RRID | AB_11124319 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21754 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Zona pellucida (ZP) is an extracellular matrix that surrounds the oocyte and early embryo, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. Mammalian ZP consists of three to four glycoproteins, called ZP1, ZP2, ZP3, ZP4. ZP3 (zona pellucida glycoprotein 3, also known as zona pellucida sperm-binding protein 3) is essential for sperm binding and zona matrix formation. Human ZP3 gene encodes predicted precursor protein of 47 kDa that is processed into mature glycoprotein with larger apparent molecular mass (PMID: 8588935; 10341000).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ZP3 antibody 21279-1-AP | Download protocol |
| IHC protocol for ZP3 antibody 21279-1-AP | Download protocol |
| IP protocol for ZP3 antibody 21279-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ZP3 antibody (Cat# 21279-1-AP) has 24 citations across journals including Cell, Nature Communications, Cell Discovery, Cell Death & Differentiation, Human Reproduction, American Journal of Human Genetics, Fertility and Sterility, iScience, and Molecular Human Reproduction. Research fields span reproductive biology (oocyte development, zona pellucida structure, folliculogenesis), infertility (empty follicle syndrome, premature ovarian insufficiency), ovarian physiology, and cancer (hepatocellular carcinoma progression via Notch signaling).
| Species | Application | Title |
|---|---|---|
Cell Extracellular GPX4 impairs antitumor immunity via dendritic ZP3 receptors.
| ||
Nat Commun TENT5-mediated polyadenylation of mRNAs encoding secreted proteins is essential for gametogenesis in mice | ||
Cell Discov Abnormal gametogenesis induced by p53 deficiency promotes tumor progression and drug resistance. | ||
Cell Death Differ Deficiency of cancer/testis antigen gene CT55 causes male infertility in humans and mice | ||
Cell Death Differ Transglutaminase 2 crosslinks zona pellucida glycoprotein 3 to prevent polyspermy. | ||
NPJ Aging Hydroxychloroquine alleviates cyclophosphamide-induced premature ovarian failure by attenuating granulosa cell senescence and modulating the mtDNA-cGAS pathway. |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating. Julia Seyfarth reported that it works well for both Western Blot and Immunofluorescence. Kathryn Grive used it at a 1:100 dilution on mouse ovary sections for Immunofluorescence and noted that it works beautifully to highlight the zona pellucida. Overall, users are satisfied with its performance across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Julia (Verified Customer) (08-18-2022) | It works well.
|
Kathryn (Verified Customer) (04-22-2022) | This antibody works beautifully to highlight the zona pellucida on mouse ovary sections.
 |
