CoraLite®594-conjugated ZP3 Polyclonal antibody

ZP3 Polyclonal Antibody for IF-P
Cat No. CL594-21279

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P

Sperm receptor, Zona pellucida glycoprotein 3, Zona pellucida protein C, Zp 3, ZP3, ZP3A, ZP3A/ZP3B, ZP3B, ZPC

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse ovary tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-21279 targets ZP3 in IF-P applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15791

Product name: Recombinant human ZP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC113949

Sequence: MVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAF

Predict reactive species
Full Name zona pellucida glycoprotein 3 (sperm receptor)
Calculated Molecular Weight 373 aa, 41 kDa
Observed Molecular Weight 47 kDa, 60 kDa
GenBank Accession NumberBC113949
Gene Symbol ZP3
Gene ID (NCBI) 7784
RRIDAB_2923916
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21754
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Zona pellucida (ZP) is an extracellular matrix that surrounds the oocyte and early embryo, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. Mammalian ZP consists of three to four glycoproteins, called ZP1, ZP2, ZP3, ZP4. ZP3 (zona pellucida glycoprotein 3, also known as zona pellucida sperm-binding protein 3) is essential for sperm binding and zona matrix formation. Human ZP3 gene encodes predicted precursor protein of 47 kDa that are processed into mature glycoprotein with larger apparent molecular mass (PMID: 8588935; 10341000).

Protocols

Product Specific Protocols
IF protocol for CL594 ZP3 antibody CL594-21279Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...