ZP3 Recombinant monoclonal antibody, PBS Only (Capture)

ZP3 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 85084-1-PBS
Clone No.242729A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

242729A8, Processed zona pellucida sperm-binding protein 3, Zona pellucida sperm-binding protein 3, Zp 3, Zp-3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85084-1-PBS targets ZP3 as part of a matched antibody pair:

MP01801-2: 85084-1-PBS capture and 85084-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15791

Product name: Recombinant human ZP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-200 aa of BC113949

Sequence: MVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAF

Predict reactive species
Full Name zona pellucida glycoprotein 3 (sperm receptor)
Calculated Molecular Weight 373 aa, 41 kDa
Observed Molecular Weight47 kDa
GenBank Accession NumberBC113949
Gene Symbol ZP3
Gene ID (NCBI) 7784
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21754
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Zona pellucida (ZP) is an extracellular matrix that surrounds the oocyte and early embryo, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. Mammalian ZP consists of three to four glycoproteins, called ZP1, ZP2, ZP3, ZP4. ZP3 (zona pellucida glycoprotein 3, also known as zona pellucida sperm-binding protein 3) is essential for sperm binding and zona matrix formation. Human ZP3 gene encodes predicted precursor protein of 47 kDa that is processed into mature glycoprotein with larger apparent molecular mass (PMID: 8588935; 10341000).

Loading...
||
New chat Able
正在加载,请稍候...