ZP3 Recombinant monoclonal antibody

• 

  WB analysis using 85084-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85084-1-RR (ZP3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 85084-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85084-1-RR (ZP3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse ovary using 85084-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 85084-1-RR (ZP3 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse ovary using 85084-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 85084-1-RR (ZP3 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse ovary using 85084-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse ovary tissue using ZP3 antibody (85084-1-RR, Clone: 242729A8 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse ovary using 85084-1-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse ovary tissue using ZP3 antibody (85084-1-RR, Clone: 242729A8 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 85084-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85084-1-RR against Human ZP3 were performed. The affinity constant is below 1 pM.

ZP3 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 85084-1-RR

Clone No.242729A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

242729A8, Processed zona pellucida sperm-binding protein 3, Zona pellucida sperm-binding protein 3, Zp 3, Zp-3

---

Tested Applications

• Positive WB detected in: LNCaP cells, A549 cells, HepG2 cells, PC-3 cells
• Positive IHC detected in: mouse ovary tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse ovary tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000
• Immunofluorescence (IF)-P: IF-P : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85084-1-RR targets ZP3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15791

  Product name: Recombinant human ZP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC113949

  Sequence: MVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAF

• Full Name: zona pellucida glycoprotein 3 (sperm receptor)
• Calculated Molecular Weight: 373 aa, 41 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC113949
• Gene Symbol: ZP3
• Gene ID (NCBI): 7784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21754
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Zona pellucida (ZP) is an extracellular matrix that surrounds the oocyte and early embryo, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. Mammalian ZP consists of three to four glycoproteins, called ZP1, ZP2, ZP3, ZP4. ZP3 (zona pellucida glycoprotein 3, also known as zona pellucida sperm-binding protein 3) is essential for sperm binding and zona matrix formation. Human ZP3 gene encodes predicted precursor protein of 47 kDa that is processed into mature glycoprotein with larger apparent molecular mass (PMID: 8588935; 10341000).