ZRANB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZRANB1 Polyclonal antibody, PBS Only (27050-1-PBS)

• 

  IP experiment of HeLa using 27050-1-AP (same clone as 27050-1-PBS)

  IP result of anti-ZRANB1 (IP:27050-1-AP, 4ug; Detection:27050-1-AP 1:500) with HeLa cells lysate 1600 ug. This data was developed using the same antibody clone with 27050-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse cerebellum using 27050-1-AP (same clone as 27050-1-PBS)

  IP result of anti-ZRANB1 (IP:27050-1-AP, 4ug; Detection:27050-1-AP 1:500) with mouse cerebellum tissue lysate 2000 ug. This data was developed using the same antibody clone with 27050-1-PBS in a different storage buffer formulation.

ZRANB1 Polyclonal Antibody for IP, Indirect ELISA

Cat No. 27050-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, Indirect ELISA

Synonyms

hTrabid, TRABID, Ubiquitin thioesterase ZRANB1

---

Product Information

27050-1-PBS targets ZRANB1 in IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25789

  Product name: Recombinant human ZRANB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of AL832925

  Sequence: MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPR

• Full Name: zinc finger, RAN-binding domain containing 1
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: AL832925
• Gene Symbol: ZRANB1
• Gene ID (NCBI): 54764
• RRID: AB_3742213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UGI0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZRANB1 is an 81-kDa deubiquitinating enzyme with an Npl14 zinc finger (NZF) domain at the N-terminus and an ovarian tumor (OTU) domain at the C-terminus. ZRANB1 specifically cleaves K29-, K33-, and K63-linked ubiquitin chains, but a mutation of amino acid 443 from cysteine to serine ablates enzymatic activity . (PMID: 36087511, PMID: 34765294)