ZSCAN21 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZSCAN21 Polyclonal antibody, PBS Only (23164-1-PBS)

• 

  WB analysis of HEK-293 using 23164-1-AP (same clone as 23164-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 23164-1-AP (ZSCAN21 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23164-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 23164-1-AP (same clone as 23164-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 23164-1-AP (ZSCAN21 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23164-1-PBS in a different storage buffer formulation.

ZSCAN21 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23164-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

23164-1-PBS targets ZSCAN21 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19595

  Product name: Recombinant human ZSCAN21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 131-282 aa of BC047309

  Sequence: GHQVSTPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYICAEC

• Full Name: zinc finger and SCAN domain containing 21
• Calculated Molecular Weight: 473 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC047309
• Gene Symbol: ZSCAN21
• Gene ID (NCBI): 7589
• RRID: AB_2879220
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5A6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.