ZSCAN5A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZSCAN5A Polyclonal antibody, PBS Only (19926-1-PBS)

• 

  WB analysis using 19926-1-AP (same clone as 19926-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19926-1-AP (ZSCAN5A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19926-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 19926-1-AP (same clone as 19926-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 19926-1-AP (ZSCAN5A antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 19926-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 19926-1-AP (same clone as 19926-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 19926-1-AP (ZSCAN5A antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 19926-1-PBS in a different storage buffer formulation.

ZSCAN5A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 19926-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Zinc finger and SCAN domain-containing protein 5A, ZNF495, ZSCAN5

---

Product Information

19926-1-PBS targets ZSCAN5A in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13898

  Product name: Recombinant human ZSCAN5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-496 aa of BC002636

  Sequence: AKALPPFACDVCEKRFTCNSKLVIHKRSHTGERLFQCNLCGKRFMQLISLQFHQRTHTGERPYTCDVCQKQFTQKSYLKCHKRSHTGEKPFECKDCKKVFTYRGSLKEHQRIHSGEKPYKCSKCPRAFSRLKLLRRHQKTHPEATSQ

• Full Name: zinc finger and SCAN domain containing 5A
• Calculated Molecular Weight: 496 aa, 56 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC002636
• Gene Symbol: ZSCAN5A
• Gene ID (NCBI): 79149
• RRID: AB_2878624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BUG6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger and SCAN domain-containing protein 5A (ZSCAN5A), also known as ZNF495 or ZSCAN5, belongs to the ZSCAN family of transcription factors. ZSCAN transcription factors contain two major domains, the zinc finger domain and the SCAN box. ZSCAN5A has two isoforms and is predicted to be located in the nucleus, it is also predicted to be involved in the regulation of transcription by RNA polymerase II and may be involved in angiogenesis, cell apoptosis, differentiation, migration and invasion, proliferation (PMID: 31218096).