ZW10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZW10 Polyclonal antibody, PBS Only (24561-1-PBS)

• 

  WB analysis using 24561-1-AP (same clone as 24561-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24561-1-AP (ZW10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24561-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24561-1-AP (same clone as 24561-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24561-1-AP (ZW10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24561-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 24561-1-AP (same clone as 24561-1-PBS)

  WB result of ZW10 antibody (24561-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZW10 transfected HeLa cells. This data was developed using the same antibody clone with 24561-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 24561-1-AP (same clone as 24561-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 24561-1-AP (ZW10 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24561-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 24561-1-AP (same clone as 24561-1-PBS)

  IP result of anti-ZW10 (IP:24561-1-AP, 4ug; Detection:24561-1-AP 1:500) with Jurkat cells lysate 3200ug. This data was developed using the same antibody clone with 24561-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24561-1-AP (same clone as 24561-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using ZW10 antibody (24561-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24561-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 24561-1-AP (same clone as 24561-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ZW10 (24561-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 24561-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZW10 Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 24561-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

Synonyms

HZW10

---

Product Information

24561-1-PBS targets ZW10 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19138

  Product name: Recombinant human ZW10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 318-672 aa of BC128264

  Sequence: NEKTSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIHNTVKIIPDSKINVPELPTPDEDNKLEVQKVSNTQYHEVMNLEPENTLDQHSFSLPTCRISESVKKLMELAYQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHLLTLGHQFRLRLAPILCDGTATFVDLVPGFRRLGTECFLAQMRAQKGELLERLSSARNFSNMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTAISEVIGKITALE

• Full Name: ZW10, kinetochore associated, homolog (Drosophila)
• Calculated Molecular Weight: 779 aa, 89 kDa
• Observed Molecular Weight: 88-90 kDa
• GenBank Accession Number: BC128264
• Gene Symbol: ZW10
• Gene ID (NCBI): 9183
• RRID: AB_2815001
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43264
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZW10 is the human homolog of the Drosophila melanogaster Zw10 protein. ZW10 is localized to kinetochores and kinetochore-associated microtubules and is an essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis(PMID: 17102640). ZW10 proteins in Drosophila and HeLa cells display a similar and intriguing cell cycle-dependent intracellular distribution. ZW10 protein first becomes localized to the kinetochore at prometaphase, but then appears to move onto the kinetochore microtubules of the spindle at metaphase, and then back to the kinetochore at anaphase(PMID: 9700164).