ZZEF1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ZZEF1 Polyclonal antibody (33605-1-AP)

• 

  WB analysis using 33605-1-AP

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 33605-1-AP (ZZEF1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ZZEF1 Polyclonal Antibody for WB, ELISA

Cat No. 33605-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

KIAA0399, Zinc finger ZZ-type and EF-hand domain-containing protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse liver tissue, mouse heart tissue, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33605-1-AP targets ZZEF1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35406

  Product name: Recombinant human ZZEF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2480-2600 aa of BC151836

  Sequence: ILRAIYELQMKKTDYFFLEVQKRFDGDELTTDERIRSLAQRWQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLISSTESELQQSYAKQRRSKSAALLHKELNCKSK

• Full Name: zinc finger, ZZ-type with EF-hand domain 1
• Observed Molecular Weight: 300-330 kDa
• GenBank Accession Number: BC151836
• Gene Symbol: ZZEF1
• Gene ID (NCBI): 23140
• RRID: AB_3743027
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O43149
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZZEF1 is a large cytoplasmic protein distinguished by a ZZ-type zinc finger and an EF-hand calcium-binding domain, hinting at a role in linking protein-protein interactions with calcium-mediated signaling. Its functions are not fully elucidated, but growing evidence suggests involvement in cilia formation, cytoskeletal organization, and cell signaling regulation. Mutations or dysregulation of ZZEF1 have been linked to ciliopathies, tumor biology, and possible neurodevelopmental conditions, making it a gene of emerging biomedical interest. (PMID: 33227311)