ZnT6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZnT6 Polyclonal antibody, PBS Only (13526-1-PBS)

• 

  WB analysis of A375 using 13526-1-AP (same clone as 13526-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 13526-1-AP (ZnT6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13526-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 13526-1-AP (same clone as 13526-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 13526-1-AP (ZnT6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13526-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZnT6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13526-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13526-1-PBS targets ZnT6 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4403

  Product name: Recombinant human SLC30A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 286-501 aa of BC032525

  Sequence: MSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPYSSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP

• Full Name: solute carrier family 30 (zinc transporter), member 6
• Calculated Molecular Weight: 460 aa, 50 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC032525
• Gene Symbol: ZnT6
• Gene ID (NCBI): 55676
• RRID: AB_2254797
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6NXT4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZnT6 (encoded by SLC30A6) is a member of zinc transporters. ZnT6 is localized on the membrane of the Golgi apparatus as well as cytoplasmic vesicles. It may function in transporting the cytoplasmic zinc into the Golgi apparatus as well as the vesicular compartment. Altered expression of ZnT6 may correlate to neural diseases including Alzheimer's disease. Several isoforms of ZnT6 exist due to the alternative splicing, with MW around 48-56 kDa.