Znt5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Znt5 Polyclonal antibody, PBS Only (25604-1-PBS)

• 

  IP experiment of mouse liver using 25604-1-AP (same clone as 25604-1-PBS)

  IP result of anti-Znt5 (IP:25604-1-AP, 4ug; Detection:25604-1-AP 1:500) with mouse liver tissue lysate 4000ug. This data was developed using the same antibody clone with 25604-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25604-1-AP (same clone as 25604-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25604-1-AP (Znt5 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25604-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Znt5 Polyclonal Antibody for IHC, IP, Indirect ELISA

Cat No. 25604-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IP, Indirect ELISA

Synonyms

SLC30A5, hZTL1, Proton-coupled zinc antiporter SLC30A5, UNQ863/PRO1879, ZnT 5

---

Product Information

25604-1-PBS targets Znt5 in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12947

  Product name: Recombinant human SLC30A5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-118 aa of BC000808

  Sequence: MEEKYGGDVLAGPGGGGGLGPVDVPSARLTKYIVLLCFTKFLKAVGLFESYDLLKAVHIVQFIFILKLGTAFFMVLFQKPFSSGKTITKHQIIGSLKIPGRKEFKDKKLNDPRKLVGN

• Full Name: solute carrier family 30 (zinc transporter), member 5
• Calculated Molecular Weight: 84 kDa
• Observed Molecular Weight: 84-87 kDa
• GenBank Accession Number: BC000808
• Gene Symbol: Znt5
• Gene ID (NCBI): 64924
• RRID: AB_2880155
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAD4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.