Zyxin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86364-3-RR (same clone as 86364-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86364-3-RR (ZYX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86364-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 86364-3-RR (same clone as 86364-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 86364-3-RR (Zyxin antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86364-3-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 86364-3-RR (same clone as 86364-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using Zyxin antibody (86364-3-RR, Clone: 250924G5 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86364-3-PBS in a different storage buffer formulation.

Zyxin Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 86364-3-PBS

Clone No.250924G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ZYX, Zyxin-2

---

Product Information

86364-3-PBS targets Zyxin in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0419

  Product name: Recombinant human ZYX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 278-572 aa of BC008743

  Sequence: SKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT

• Full Name: zyxin
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC008743
• Gene Symbol: Zyxin
• Gene ID (NCBI): 7791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15942
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin (ZYX) is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles.