Zyxin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86364-3-RR (same clone as 86364-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86364-3-RR (ZYX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86364-3-PBS in a different storage buffer formulation.

Zyxin Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86364-3-PBS

Clone No.250924G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ZYX, Zyxin-2

---

Product Information

86364-3-PBS targets Zyxin in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0419

  Product name: Recombinant human ZYX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 278-572 aa of BC008743

  Sequence: SKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT

• Full Name: zyxin
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC008743
• Gene Symbol: Zyxin
• Gene ID (NCBI): 7791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15942
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.