Zyxin Recombinant monoclonal antibody

• 

  WB analysis using 86364-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86364-3-RR (ZYX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

Zyxin Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86364-3-RR

Clone No.250924G5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ZYX, Zyxin-2

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, A431 cells, MCF-7 cells, Daudi cells, NIH/3T3 cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86364-3-RR targets Zyxin in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0419

  Product name: Recombinant human ZYX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 278-572 aa of BC008743

  Sequence: SKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQGQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQT

• Full Name: zyxin
• Calculated Molecular Weight: 80 kDa
• Observed Molecular Weight: 78 kDa
• GenBank Accession Number: BC008743
• Gene Symbol: Zyxin
• Gene ID (NCBI): 7791
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15942
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.