Band 3/AE 1 Monoclonal antibody

• 

  IHC staining of human placenta using 66984-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66984-1-Ig (band 3/ AE1 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 66984-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 66984-1-Ig (band 3/ AE1 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using 66984-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Band 3/AE 1 antibody (66984-1-Ig, Clone: 1E5C1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human placenta using 66984-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using Band 3/AE 1 antibody (66984-1-Ig, Clone: 1E5C1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Band 3/AE 1 Monoclonal Antibody for IHC, IF-P, ELISA

Cat No. 66984-1-Ig

Clone No.1E5C1

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

IHC, IF-P, ELISA

Synonyms

band 3, band 3/ AE1, SLC4A1, 1E5C1, AE 1

---

Tested Applications

• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human placenta tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:5000-1:20000
• Immunofluorescence (IF)-P: IF-P : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

66984-1-Ig targets Band 3/AE 1 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28058

  Product name: Recombinant human SLC4A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-200 aa of BC101570

  Sequence: MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF

• Full Name: solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)
• Calculated Molecular Weight: 911 aa, 102 kDa
• GenBank Accession Number: BC101570
• Gene Symbol: band 3
• Gene ID (NCBI): 6521
• RRID: AB_2918479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02730
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Anion exchanger 1 (AE1), also known as band 3, is a 95-100 kDa transmembrane glycoprotein which is abundantly expressed in erythrocyte plasma membrane and mediates the electroneutral exchange of Cl- and HCO3-. It contains a 52-55 kDa C-terminal membrane crossing domain and a 43 kDa N-terminal cytoplasmic domain. Degradation of band 3 protein occurred during erythrocyte aging. The oxidative stress can also activate the proteolysis of band 3 through caspases. This antibody is expected to recognize the intact band 3 (95-100 kDa) and various degradation products (38-60 kDa). (PMID: 22890269, 29240292, 28130418)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Neuron; Single-cell dissection of the human blood-brain barrier and glioma blood-tumor barrier; Authors - Yuan Xie