CoraLite®594-conjugated Band 3/AE 1 Monoclonal antibody

Band 3/AE 1 Monoclonal Antibody for IF-P
Cat No. CL594-66984
Clone No.1E5C1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF-P

band 3, band 3/ AE1, SLC4A1, Anion exchanger 1, Anion exchange protein 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman placenta tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66984 targets Band 3/AE 1 in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28058

Product name: Recombinant human SLC4A1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-200 aa of BC101570

Sequence: MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLF

Predict reactive species
Full Name solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)
Calculated Molecular Weight 911 aa, 102 kDa
GenBank Accession NumberBC101570
Gene Symbol band 3
Gene ID (NCBI) 6521
RRIDAB_2934753
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP02730
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Anion exchanger 1 (AE1), also known as band 3, is a 95-100 kDa transmembrane glycoprotein which is abundantly expressed in erythrocyte plasma membrane and mediates the electroneutral exchange of Cl- and HCO3-. It contains a 52-55 kDa C-terminal membrane crossing domain and a 43 kDa N-terminal cytoplasmic domain. Degradation of band 3 protein occurred during erythrocyte aging. The oxidative stress can also activate the proteolysis of band 3 through caspases. This antibody is expected to recognize the intact band 3 (95-100 kDa) and various degradation products (38-60 kDa). (PMID: 22890269, 29240292, 28130418)

Protocols

Product Specific Protocols
IF protocol for CL594 Band 3/AE 1 antibody CL594-66984Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...