Mouse cGAS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Mouse cGAS Polyclonal antibody, PBS Only (29958-1-PBS)

• 

  WB analysis using 29958-1-AP (same clone as 29958-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29958-1-AP (cGAS antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 29958-1-AP (same clone as 29958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 29958-1-AP (cGAS antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 29958-1-AP (same clone as 29958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29958-1-AP (cGAS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 29958-1-AP (same clone as 29958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29958-1-AP (cGAS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 29958-1-AP (same clone as 29958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29958-1-AP (cGAS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 29958-1-AP (same clone as 29958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29958-1-AP (cGAS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29958-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 29958-1-AP (same clone as 29958-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29958-1-AP (cGAS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29958-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 29958-1-AP (same clone as 29958-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using cGAS antibody (29958-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). This data was developed using the same antibody clone with 29958-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

cGAS Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29958-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

m cGAS, Mb21d1, mcGAS, m-cGAS

---

Product Information

29958-1-PBS targets cGAS in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31677

  Product name: Recombinant mouse cGAS protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 350-507 aa of BC145651

  Sequence: KNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL

• Full Name: RIKEN cDNA E330016A19 gene
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: BC145651
• Gene Symbol: cGAS
• Gene ID (NCBI): 214763
• RRID: AB_2935491
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8C6L5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

cGAS (cyclic GMP-AMP synthase) is a cytosolic DNA sensor that serves to mount an immune response against the invasion of microbial pathogens such as viruses. cGAS normally resides as an inactive protein in the cell. Upon binding to DNA, cGAS undergoes a conformational change to an active state and produces the second messenger cyclic GMP-AMP (cGAMP) from ATP and GTP, which is subsequently detected by the cyclic-dinucleotide sensor STING, an ~40 kDa dimeric transmembrane protein at the endoplasmic reticulum (ER). cGAS not only is found in the cytosol but has a multifaceted cellular distribution that involves localization at the cell membrane and in the nucleus (PMID: 32424334). The calculated molecular weight of cGAS is 58 kDa. With post-translational modification, the MW of cGAS will be migrated to 70 kDa.