CoraLite® Plus 488-conjugated cGAS Recombinant monoclonal antibody

cGAS Recombinant Antibody for IF/ICC
Cat No. CL488-84045
Clone No.240964E2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF/ICC

m-cGAS, mcGAS, Mb21d1, m cGAS, 240964E2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inRAW 264.7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84045 targets cGAS in IF/ICC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag31677

Product name: Recombinant mouse cGAS protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 350-507 aa of BC145651

Sequence: KNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL

Predict reactive species
Full Name RIKEN cDNA E330016A19 gene
Calculated Molecular Weight58 kDa
Observed Molecular Weight58 kDa
GenBank Accession NumberBC145651
Gene Symbol cGAS
Gene ID (NCBI) 214763
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8C6L5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

cGAS (cyclic GMP-AMP synthase) is a cytosolic DNA sensor that serves to mount an immune response against the invasion of microbial pathogens such as viruses. cGAS normally resides as an inactive protein in the cell. Upon binding to DNA, cGAS undergoes a conformational change to an active state and produces the second messenger cyclic GMP-AMP (cGAMP) from ATP and GTP, which is subsequently detected by the cyclic-dinucleotide sensor STING, an ~40 kDa dimeric transmembrane protein at the endoplasmic reticulum (ER). cGAS not only is found in the cytosol but has a multifaceted cellular distribution that involves localization at the cell membrane and in the nucleus (PMID: 32424334). The calculated molecular weight of cGAS is 58 kDa. With post-translational modification, the MW of cGAS will be migrated to 70 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 cGAS antibody CL488-84045Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...