calreticulin Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 80017-1-RR (same clone as 80017-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 80017-1-RR (calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80017-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 80017-1-RR (same clone as 80017-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 80017-1-RR (calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80017-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 80017-1-RR (same clone as 80017-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 80017-1-RR (calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80017-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 80017-1-RR (same clone as 80017-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 80017-1-RR (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80017-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 80017-1-RR (same clone as 80017-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 80017-1-RR (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80017-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 80017-1-RR (same clone as 80017-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 80017-1-RR (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80017-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 80017-1-RR (same clone as 80017-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 80017-1-RR (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80017-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 80017-1-RR

  Biolayer interferometry (BLl) kinetic assays of 80017-1-RR against Human calreticulin were performed. The affinity constant is 6.07 nM.

calreticulin Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 80017-1-PBS

Clone No.2B17

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CALR, Calregulin, 2B17

---

Product Information

80017-1-PBS targets calreticulin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26064

  Product name: Recombinant human calreticulin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 248-417 aa of BC002500

  Sequence: KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

• Full Name: calreticulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC002500
• Gene Symbol: Calreticulin
• Gene ID (NCBI): 811
• RRID: AB_2882941
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27797
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.