eIF4G2/DAP5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67428-1-Ig (same clone as 67428-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67428-1-Ig (EIF4G2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67428-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67428-1-Ig (same clone as 67428-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67428-1-Ig (eIF4G2/DAP5 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67428-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67428-1-Ig (same clone as 67428-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67428-1-Ig (EIF4G2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67428-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67428-1-Ig (same clone as 67428-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67428-1-Ig (eIF4G2/DAP5 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67428-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 67428-1-Ig (same clone as 67428-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 67428-1-Ig (eIF4G2/DAP5 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67428-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67428-1-Ig (same clone as 67428-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67428-1-Ig (EIF4G2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67428-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67428-1-Ig (same clone as 67428-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 67428-1-Ig (EIF4G2 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67428-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67428-1-Ig (same clone as 67428-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using eIF4G2/DAP5 antibody (67428-1-Ig, Clone: 3C11A3 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67428-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

eIF4G2/DAP5 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67428-1-PBS

Clone No.3C11A3

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EIF4G2, 3C11A3, AAG1, DAP 5, DAP5

---

Product Information

67428-1-PBS targets eIF4G2/DAP5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12080

  Product name: Recombinant human EIF4G2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 563-907 aa of BC043149

  Sequence: EAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEESEEEAD

• Full Name: eukaryotic translation initiation factor 4 gamma, 2
• Calculated Molecular Weight: 907 aa, 102 kDa
• Observed Molecular Weight: 97 kDa
• GenBank Accession Number: BC043149
• Gene Symbol: EIF4G2
• Gene ID (NCBI): 1982
• RRID: AB_2882667
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P78344
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.