hCG Beta Polyclonal antibody

• Home
• Products
• Primary Antibodies
• hCG Beta Polyclonal antibody (33278-1-AP)

• 

  WB analysis using 33278-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33278-1-AP (hCG Beta antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. Negative control: human heart tissue, human kidney tissue.

• 

  IHC staining of human placenta using 33278-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 33278-1-AP (hCG Beta antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 33278-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 33278-1-AP (hCG Beta antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

hCG Beta Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33278-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CGB5, hCG, hCGB

---

Tested Applications

• Positive WB detected in: JAR cells, Forskolin treated JAR cells
• Positive IHC detected in: human placenta tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33278-1-AP targets hCG Beta in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38044

  Product name: Recombinant human CGB5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-165 aa of BC051378

  Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

• Full Name: chorionic gonadotropin, beta polypeptide 5
• Calculated Molecular Weight: 165 aa, 18 kDa
• Observed Molecular Weight: 19, 21 kDa
• GenBank Accession Number: BC051378
• Gene Symbol: CGB5
• Gene ID (NCBI): 93659
• RRID: AB_3742923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P0DN86
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Beta-hCG (beta-human chorionic gonadotropin) is a glycoprotein hormone produced by the placenta during pregnancy. It is a critical marker used in both obstetrics and oncology for various diagnostic and monitoring purposes. hCG is composed of two subunits: an alpha subunit (similar to other glycoprotein hormones like LH, FSH, and TSH) and a unique beta subunit (β-hCG). The beta subunit is the primary focus for diagnostic tests due to its specificity. β-hCG is initially secreted by the syncytiotrophoblast cells surrounding the developing embryo and later by the placenta.