hCG Beta Monoclonal antibody, PBS Only (Detector)

hCG Beta Monoclonal Antibody for IHC, Cytometric bead array, Indirect ELISA
Cat No. 60334-1-PBS
Clone No.2D6B8

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IHC, Cytometric bead array, Indirect ELISA

CGB, CGB,hCG, CG beta, CGB3, CGbeta

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60334-1-PBS targets hCG Beta as part of a matched antibody pair:

MP50292-1: 60334-2-PBS capture and 60334-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2191

Product name: Recombinant human CGB,hCG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-165 aa of BC022796

Sequence: MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

Predict reactive species
Full Name CG beta
Calculated Molecular Weight 165 aa, 18 kDa
GenBank Accession NumberBC022796
Gene Symbol hCG Beta
Gene ID (NCBI) 1082
RRIDAB_2881443
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP0DN86
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Beta-hCG (beta-human chorionic gonadotropin) is a glycoprotein hormone produced by the placenta during pregnancy. It is a critical marker used in both obstetrics and oncology for various diagnostic and monitoring purposes. hCG is composed of two subunits: an alpha subunit (similar to other glycoprotein hormones like LH, FSH, and TSH) and a unique beta subunit (β-hCG). The beta subunit is the primary focus for diagnostic tests due to its specificity. β-hCG is initially secreted by the syncytiotrophoblast cells surrounding the developing embryo and later by the placenta.

Loading...
||
New chat Able
正在加载,请稍候...