iPLA2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• iPLA2 Recombinant monoclonal antibody (86812-1-RR)

• 

  WB analysis using 86812-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86812-1-RR (iPLA2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 86812-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86812-1-RR against Human iPLA2 were performed. The affinity constant is 7.47 nM.

iPLA2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86812-1-RR

Clone No.251854E4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

PLA2G6, 2-lysophosphatidylcholine acylhydrolase, 85/88 kDa calcium-independent phospholipase A2, CaI PLA2, CaI-PLA2

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue, rat liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86812-1-RR targets iPLA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36873

  Product name: Recombinant human PLA2G6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-343 aa of BC036742

  Sequence: MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANA

• Full Name: phospholipase A2, group VI (cytosolic, calcium-independent)
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 85-90 kDa
• GenBank Accession Number: BC036742
• Gene Symbol: PLA2G6
• Gene ID (NCBI): 8398
• RRID: AB_3745136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60733
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLA2G6, also named as PLPLA9, iPLA2, is involved in the remodeling of membranes allowing arachidonic acid to be placed in the proper position in phospholipids for stimulated release. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production.