luciferase Monoclonal antibody, PBS Only

• 

  WB analysis of ag13000 using 67293-1-Ig (same clone as 67293-1-PBS)

  Luciferase tagged protein were subjected to SDS PAGE followed by western blot with 67293-1-Ig (Luciferase antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67293-1-PBS in a different storage buffer formulation.

luciferase Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67293-1-PBS

Clone No.2D2E1

Host / Isotype

Mouse / IgG2a

Reactivity

Gaussia princeps

Applications

WB, Indirect ELISA

Synonyms

Luciferase, redLUC

---

Product Information

67293-1-PBS targets luciferase in WB, Indirect ELISA applications and shows reactivity with Gaussia princeps samples.

• Tested Reactivity: Gaussia princeps
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13000

  Product name: Recombinant dNGLUC protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-185 aa of AY015993

  Sequence: MGVKVLFALICIAVAEAKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD

• Full Name: luciferase
• Calculated Molecular Weight: 20 kDa
• GenBank Accession Number: AY015993
• RRID: AB_2882558
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

This antibody is designed to detect the luciferase of luciferase (Gaussia princeps) tagged protein.