p107 Recombinant monoclonal antibody, PBS Only

p107 Uni-rAb® Recombinant Antibody for WB, IP, Indirect ELISA
Cat No. 87119-3-PBS
Clone No.252269F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

107 kDa retinoblastoma-associated protein, CP107, PRB1, RBL1, retinoblastoma like 1 (p107)

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87119-3-PBS targets p107 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4146

Product name: Recombinant human RBL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC032247

Sequence: MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLACSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFTASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSKAVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANV

Predict reactive species
Full Name retinoblastoma-like 1 (p107)
Calculated Molecular Weight 1068 aa, 119 kDa
Observed Molecular Weight 119 kDa
GenBank Accession NumberBC032247
Gene Symbol p107
Gene ID (NCBI) 5933
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP28749
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Retinoblastoma-like protein 1, also named RBL1, p107, is a member of E1A-binding proteins, which contains a A/B pocket, or pRb. Via this structure, RBL1 can bind to viral oncoproteins and other perteins containing LXCXE motif. It regulates cell proliferation via phosphorylation-sensitive interactions with E2F transcription factors and other proteins. Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression.(uniprot). It has been reported there are two transcirpts variants of RBL1, which encode a 119-kd protein and a 68-kd protein(PMID:7490090).

Loading...
||
New chat

Able

正在加载,请稍候...