p107 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87119-3-RR (same clone as 87119-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87119-3-RR (RBL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87119-3-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 87119-3-RR (same clone as 87119-3-PBS)

  IP result of anti-p107 (IP:87119-3-RR, 4ug; Detection:87119-3-RR 1:600) with MCF-7 cells lysate 1120 ug. This data was developed using the same antibody clone with 87119-3-PBS in a different storage buffer formulation.

• 

  Affinity of 87119-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87119-3-RR against Human 怕07 were performed. The affinity constant is 0.354 nM.

p107 Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 87119-3-PBS

Clone No.252269F11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

107 kDa retinoblastoma-associated protein, CP107, PRB1, RBL1, retinoblastoma like 1 (p107)

---

Product Information

87119-3-PBS targets p107 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4146

  Product name: Recombinant human RBL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC032247

  Sequence: MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLACSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFTASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSKAVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANV

• Full Name: retinoblastoma-like 1 (p107)
• Calculated Molecular Weight: 1068 aa, 119 kDa
• Observed Molecular Weight: 119 kDa
• GenBank Accession Number: BC032247
• Gene Symbol: p107
• Gene ID (NCBI): 5933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28749
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Retinoblastoma-like protein 1, also named RBL1, p107, is a member of E1A-binding proteins, which contains a A/B pocket, or pRb. Via this structure, RBL1 can bind to viral oncoproteins and other perteins containing LXCXE motif. It regulates cell proliferation via phosphorylation-sensitive interactions with E2F transcription factors and other proteins. Key regulator of entry into cell division. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression.(uniprot). It has been reported there are two transcirpts variants of RBL1, which encode a 119-kd protein and a 68-kd protein(PMID:7490090).