CoraLite® Plus 488 Anti-Mouse uPAR/CD87 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• CoraLite® Plus 488 Anti-Mouse uPAR/CD87 Rabbit Recombinant Antibody (CL488-98424-3)

uPAR/CD87 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL488-98424-3 Copied!

Clone No. 242976A9

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD87, Plaur, uPAR, U-PAR, Urokinase plasminogen activator surface receptor

• 

  FC experiment of RAW 264.7 using CL488-98424-3

  1x10^6 RAW 264.7 cells were surface stained with 0.25 ug CoraLite® Plus 488 Anti-Mouse uPAR/CD87 Rabbit RecAb (CL488-98424-3, Clone: 242976A9) (red) or CoraLite® Plus 488 Rabbit IgG Isotype Control Recombinant Antibody (CL488-98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for uPAR/CD87 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: RAW 264.7 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-98424-3 targets uPAR/CD87 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3156

  Product name: Recombinant Mouse uPAR/CD87 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 24-297 aa of NM_011113.4

  Sequence: LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT

• Full Name: plasminogen activator, urokinase receptor
• Calculated Molecular Weight: 35 kDa
• GenBank Accession Number: NM_011113.4
• Gene Symbol: Plaur
• Gene ID (NCBI): 18793
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P35456
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

uPAR, also known as CD87, is a highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodeling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559)