• Featured Product
  • KD/KO Validated

ACE2 Monoclonal antibody

ACE2 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66699-1-Ig
Clone No.2F12A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, IP, ELISA

2F12A4, ACE related carboxypeptidase, ACEH, ACE-related carboxypeptidase, Angiotensin converting enzyme 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman testis tissue, human skeletal muscle tissue
Positive IHC detected inhuman small intestine tissue, human colon tissue, human colon cancer tissue, human kidney tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman kidney tissue, mouse testis tissue, mouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:6000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66699-1-Ig targets ACE2 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, monkey
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15554

Product name: Recombinant human ACE2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 392-744 aa of BC048094

Sequence: LRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI

Predict reactive species
Full Name angiotensin I converting enzyme (peptidyl-dipeptidase A) 2
Calculated Molecular Weight 805 aa, 92 kDa
Observed Molecular Weight 120 kDa, 92 kDa
GenBank Accession NumberBC048094
Gene Symbol ACE2
Gene ID (NCBI) 59272
RRIDAB_2882052
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BYF1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ACE2 (Angiotensin-converting enzyme 2), also named as ACEH, is a zinc metalloprotease of the ACE family and a critical regulator of the reninangiotensin system. ACE2 has a more restricted tissue distribution than ACE, being found predominantly in the heart, kidneys, and testes although low levels have been detected in a variety of tissues (PMID:15983030). ACE2 has been shown to be a functional receptor of the human coronaviruses SARS-CoV and SARS-CoV-2 (PMID: 32142651). The expression level and expression pattern of human ACE2 in different tissues might be critical for the susceptibility, symptoms, and outcome of 2019-nCoV/SARS-CoV-2 infection (PMID: 32133153). It can be used as a potential therapeutic target of SARS-CoV-2 (PMID: 32125455). The calculated molecular weight of ACE2 is 92kDa but it migrates to 120kDa due to N-glycosylation (PMID:16166094). Sometimes, several cleaved fragments can also be detected as 75kDa, 50 kDa or 37kDa (PMID: 29561187, 22009550, 30759273). It has 2 isoforms produced by alternative splicing. This antibody is specific to ACE2. The location of ACE2 is membrane and cytoplasm, however it accumulates in the nucleus during the mitosis (PMID: 1730413/PMID: 18292088).

Protocols

Product Specific Protocols
IF protocol for ACE2 antibody 66699-1-IgDownload protocol
IHC protocol for ACE2 antibody 66699-1-IgDownload protocol
WB protocol for ACE2 antibody 66699-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Science

Neuropilin-1 is a host factor for SARS-CoV-2 infection.

Authors - James L Daly
humanIF

Nat Med

SARS-CoV-2 infection of the oral cavity and saliva.

Authors - Ni Huang
humanIF

Cell Stem Cell

Androgen Signaling Regulates SARS-CoV-2 Receptor Levels and Is Associated with Severe COVID-19 Symptoms in Men.

Authors - Ryan M Samuel
humanIHC

Ocul Surf

SARS-CoV-2 receptor ACE2 is expressed in human conjunctival tissue, especially in diseased conjunctival tissue.

Authors - Shengjie Li
humanWB

Cell Death Differ

SARS-CoV-2 spike protein dictates syncytium-mediated lymphocyte elimination.

Authors - Zhengrong Zhang
mouseWB

J Control Release

Peritoneal M2 macrophage-derived extracellular vesicles as natural multitarget nanotherapeutics to attenuate cytokine storms after severe infections.

Authors - Yizhuo Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lindsey (Verified Customer) (05-24-2021)

Great antibody---looking forward to trying the RabPolyAb as well

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human lung (FFPE); mouse lung (OCT/frozen)
ACE2 Antibody Immunohistochemistry,Immunofluorescence validation (1:1000 dilution) in Human lung (FFPE); mouse lung (OCT/frozen) (Cat no:66699-1-Ig)
FH

Lindsey (Verified Customer) (09-21-2020)

Perfomed IF analysis on human FFPE and mouse frozen tissue sections; for FFPE tissue, antigen retrieval was performed for 30 min at 95C using Tris EDTA Buffer (pH9.0); Permeabilization was not performed; Blocking was performed using 5% Normal Serum and 0.3% TritonX-100 for 30. minutes at room temperature. Mouse lung sections were costained with ARL13B (Proteintech #1711-1-AP) to visualize primary cilia of the lung epithelia; all sections were counterstained with DAPI Fluormount (Abcam); image attached is of mouse lung frozen tissue; due to size restrictions I am limited to this image only but am happy to provide additional images (human tissue etc.) upon request

  • Applications: Immunohistochemistry, Immunofluorescence, Other
  • Primary Antibody Dilution: 1:1000 (works best for IF with FFPE @ 1:500)
  • Cell Tissue Type: Human lung (FFPE); mouse lung (OCT/frozen)
ACE2 Antibody Immunohistochemistry,Immunofluorescence,Other validation (1:1000 (works best for IF with FFPE @ 1:500) dilution) in Human lung (FFPE); mouse lung (OCT/frozen) (Cat no:66699-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...