Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, U-87 MG cells, K-562 cells, Raji cells |
| Positive IHC detected in | mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue, human lung tissue |
| Positive FC (Intra) detected in | HepG2 cells, A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81990-4-RR targets Angiopoietin 1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag18829 Product name: Recombinant human ANGPT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 161-293 aa of BC152411 Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG Predict reactive species |
| Full Name | angiopoietin 1 |
| Calculated Molecular Weight | 498 aa, 58 kDa |
| Observed Molecular Weight | 70 kDa |
| GenBank Accession Number | BC152411 |
| Gene Symbol | Angiopoietin 1 |
| Gene ID (NCBI) | 284 |
| RRID | AB_3670511 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15389 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Angiopoietin 1 antibody 81990-4-RR | Download protocol |
| IF protocol for Angiopoietin 1 antibody 81990-4-RR | Download protocol |
| IHC protocol for Angiopoietin 1 antibody 81990-4-RR | Download protocol |
| WB protocol for Angiopoietin 1 antibody 81990-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Angiopoietin 1 Recombinant monoclonal antibody (240764D10), catalog number 81990-4-RR, has 1 total citation. It appears in the British Journal of Pharmacology (IF 7.5), in a study on selective degradation of PDE4B shortform via PROTAC and its inhibition of cancer hallmarks in HCT116 cells. The associated research field is cancer pharmacology, specifically targeting angiogenesis-related pathways in colorectal cancer models.
| Species | Application | Title |
|---|---|---|
Br J Pharmacol The selective degradation of PDE4B shortform, using a PROTAC, leads to inhibition of several hallmarks of cancer in HCT116 cells. |
Reviews
What customers say
Both reviewers used the antibody for Western Blot and reported positive results. One user observed three bands at approximately 55, 75, and 125 kDa in A549 cells at a 1:4000 dilution. The other user tested it on tumoral cells, endothelial cells, and mouse fibroblasts at 1:500 and 1:1000 dilutions, noting strong specificity for ANG1. Overall, the antibody received favorable ratings (4 and 5 stars), with users highlighting reliable band detection and good specificity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Angie (Verified Customer) (07-25-2025) | The antibody detected 3 bands around 55 kD, 75 kDa and 125 kDa at dilution of 1:4000 incubated at room temperature for 2 hours followed by secondary antibody donkey-anti-rabbit (Alexa Fluor 800) at 1:20000 dilution, incubated 1 hour at room temperature.
 |
Marine (Verified Customer) (07-01-2025) | It works well, it is specific with ANG1
 |
