Angiopoietin 1 Recombinant monoclonal antibody

Angiopoietin 1 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 81990-4-RR
Clone No.240764D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, FC (Intra), ELISA

ANGPT1, 240764D10, AGP1, AGPT, ANG 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells, U-87 MG cells, K-562 cells, Raji cells
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue, human lung tissue
Positive FC (Intra) detected inHepG2 cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81990-4-RR targets Angiopoietin 1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18829

Product name: Recombinant human ANGPT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 161-293 aa of BC152411

Sequence: IQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKEGVLLKGGKREEEKPFRDCADVYQAG

Predict reactive species
Full Name angiopoietin 1
Calculated Molecular Weight 498 aa, 58 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC152411
Gene Symbol Angiopoietin 1
Gene ID (NCBI) 284
RRIDAB_3670511
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ15389
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiopoietin 1 is a 70-kDa secreted glycoprotein generated from vascular mural cells, pericytes, and certain other cells. Angiopoietin 1 participates in vascular differentiation through angiogenesis, which is the process of the growth and remodelling of existing vessels. Angiopoietin 1 is also involved in the maintenance and turnover of blood vessels in mature animals. Angiopoietin 1 binds to and activates the TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation, playing an important role in the regulation of angiogenesis. Overexpression of Angiopoietin 1 has been proven to occur in malignant glioblastoma, neuroblastoma, non-small cell lung cancer, and other tumors.

Protocols

Product Specific Protocols
FC protocol for Angiopoietin 1 antibody 81990-4-RRDownload protocol
IF protocol for Angiopoietin 1 antibody 81990-4-RRDownload protocol
IHC protocol for Angiopoietin 1 antibody 81990-4-RRDownload protocol
WB protocol for Angiopoietin 1 antibody 81990-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Angie (Verified Customer) (07-25-2025)

The antibody detected 3 bands around 55 kD, 75 kDa and 125 kDa at dilution of 1:4000 incubated at room temperature for 2 hours followed by secondary antibody donkey-anti-rabbit (Alexa Fluor 800) at 1:20000 dilution, incubated 1 hour at room temperature.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:4000
  • Cell Tissue Type: A549
Angiopoietin 1 Antibody Western Blot validation (1:4000 dilution) in A549 (Cat no:81990-4-RR)
FH

Marine (Verified Customer) (07-01-2025)

It works well, it is specific with ANG1

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/500 and 1/1000
  • Cell Tissue Type: Tumoral cells, endothelial cells, mouse fibroblasts
Angiopoietin 1 Antibody Western Blot validation (1/500 and 1/1000 dilution) in Tumoral cells, endothelial cells, mouse fibroblasts (Cat no:81990-4-RR)
Loading...
||
New chat

Able

正在加载,请稍候...