Use Able AI chat for product recommendations

ANGPTL4 Monoclonal antibody

ANGPTL4 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67577-1-Ig
Clone No. 1D2H6
Publications (3)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Angiopoietin-related protein 4, Angiopoietin-like protein 4, Angiopoietin related protein 4, Angiopoietin like protein 4, angiopoietin like 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ANGPTL4 in ?

Tested Applications

Positive WB detected inhuman placenta tissue, COLO 320 cells, Caco-2 cells, HT-29 cells, mouse brain tissue, A549 cells
Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67577-1-Ig targets ANGPTL4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30070

Product name: Recombinant human ANGPTL4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-374 aa of BC023647

Sequence: MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKL

Predict reactive species
Full Name angiopoietin-like 4
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC023647
Gene Symbol ANGPTL4
Gene ID (NCBI) 51129
RRIDAB_2882790
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BY76
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Angiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. ANGPTL4 has three isoforms, 45 kDa, 41 kDa and 27 kDa.

Protocols

Product Specific Protocols
IF protocol for ANGPTL4 antibody 67577-1-IgDownload protocol
WB protocol for ANGPTL4 antibody 67577-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ANGPTL4 Monoclonal antibody (1D2H6), catalog number 67577-1-Ig, has a total of 3 citations. These appear in Journal of Clinical Investigation, BMC Biology, and Frontiers in Immunology. The associated research fields include lipid metabolism and triglyceride clearance, molecular and cellular consequences of Nocardia infection, and aortic dissection–enriched macrophage subpopulations identified through single-cell and bulk RNA sequencing.

SpeciesApplicationTitle
mouseWB

J Clin Invest

Absence of intracellular lipolytic inhibitor G0S2 enhances intravascular triglyceride clearance and abolishes diet-induced hypertriglyceridemia

Authors - Yongbin Chen
  • KD Validated
humanWB,IF

BMC Biol

Molecular, cellular and neurological consequences of infection by the neglected human pathogen Nocardia

Authors - Xingzhao Ji

Front Immunol

Integration of single-cell and bulk RNA sequencing data identified an aortic dissection-enriched ANGPTL4+ macrophage subpopulation.

Authors - Zhenghao Li
Loading...
||
New chat

Able™

正在加载,请稍候...