CoraLite® Plus 488-conjugated ANGPTL4 Monoclonal antibody

ANGPTL4 Monoclonal Antibody for IF/ICC

Cat No. CL488-67577
Clone No.1D2H6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

IF/ICC

Angiopoietin-related protein 4, Angiopoietin-like protein 4, Angiopoietin related protein 4, Angiopoietin like protein 4, angiopoietin like 4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67577 targets ANGPTL4 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30070

Product name: Recombinant human ANGPTL4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-374 aa of BC023647

Sequence: MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKL

Predict reactive species
Full Name angiopoietin-like 4
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45-50 kDa
GenBank Accession NumberBC023647
Gene Symbol ANGPTL4
Gene ID (NCBI) 51129
RRIDAB_2934554
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9BY76
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Angiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. ANGPTL4 has three isoforms, 45 kDa, 41 kDa and 27 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 ANGPTL4 antibody CL488-67577Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...