• Featured Product
  • KD/KO Validated

AP1M1 Recombinant monoclonal antibody

AP1M1 Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83613-6-RR
Clone No.240553H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

AP-1 complex subunit mu-1, AP mu chain family member mu1A, AP 1 complex subunit mu 1, Adaptor-related protein complex 1 subunit mu-1, Adaptor protein complex AP-1 subunit mu-1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HEK-293 cells, mouse testis tissue, PC-3 cells, K-562 cells, Jurkat cells, rat testis tissue
Positive IHC detected inmouse skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells, U-251 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83613-6-RR targets AP1M1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2757

Product name: Recombinant human AP1M1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 164-423 aa of BC017469

Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ

Predict reactive species
Full Name adaptor-related protein complex 1, mu 1 subunit
Calculated Molecular Weight 423 aa, 49 kDa
Observed Molecular Weight 49 kDa
GenBank Accession NumberBC017469
Gene Symbol AP1M1
Gene ID (NCBI) 8907
RRIDAB_3671226
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9BXS5
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP1M1, also named as CLTNM, Mu-adaptin 1 and Clathrin coat assembly protein AP47, belongs to the adaptor complexes medium subunit family. It is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.

Protocols

Product Specific Protocols
WB protocol for AP1M1 antibody 83613-6-RRDownload protocol
IHC protocol for AP1M1 antibody 83613-6-RRDownload protocol
FC protocol for AP1M1 antibody 83613-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...