ATP6V1C1 Recombinant monoclonal antibody

ATP6V1C1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 86345-2-RR
Clone No.250958C3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

ATP6C, ATP6D, VATC, V-ATPase subunit C 1, Vma5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, U-251 cells, NIH/3T3 cells, mouse brain tissue, fetal human brain tissue, human testis tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86345-2-RR targets ATP6V1C1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9020

Product name: Recombinant human ATP6V1C1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-381 aa of BC010960

Sequence: MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEF

Predict reactive species
Full Name ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1
Calculated Molecular Weight 382 aa, 44 kDa
Observed Molecular Weight 42-44 kDa
GenBank Accession NumberBC010960
Gene Symbol ATP6V1C1
Gene ID (NCBI) 528
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21283
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The vacuolar H+-ATPase (V-ATPase) is a functionally conserved multimeric complex localized at the membranes of many organelles where its proton-pumping action is required for proper lumen acidification (PMID: 39210597). ATP6V1C1, also known as ATPase, H+ transporting, lysosomal V1 subunit C1, is a component of the V1 sector of the V-ATPase complex. ATP6v1c1 knockdown significantly reduces tumor stimulated bone resorption through osteoclastogenesis at the bone and metastasis in vivo, as well as V-ATPase activity, proliferation, and mTORC1 activation in vitro (PMID: 28504970). Also, ATP6V1C1, associated with the tumor microenvironment and mTORC1 signaling pathway, is a potential diagnostic, prognostic, and therapeutic biomarker for hepatocellular carcinoma () (PMID: 39557733).

Protocols

Product Specific Protocols
IF protocol for ATP6V1C1 antibody 86345-2-RRDownload protocol
IHC protocol for ATP6V1C1 antibody 86345-2-RRDownload protocol
WB protocol for ATP6V1C1 antibody 86345-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...