BRCC3 Recombinant monoclonal antibody

BRCC3 Uni-rAb® Recombinant Antibody for WB, IHC, IP, ELISA
Cat No. 85430-4-RR
Clone No.242931B9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

BRCA1/BRCA2-containing complex subunit 3, BRCA1/BRCA2-containing complex subunit 36, BRCA1-A complex subunit BRCC36, BRCC36, BRISC complex subunit BRCC36

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSK-BR-3 cells, HeLa cells, HEK-293T cells, MCF-7 cells, HT-29 cells, Neuro-2a cells, HSC-T6 cells
Positive IP detected inSK-BR-3 cells
Positive IHC detected inhuman ovary cancer tissue, Human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85430-4-RR targets BRCC3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7584

Product name: Recombinant human BRCC3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 14-316 aa of BC002999

Sequence: LESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE

Predict reactive species
Full Name BRCA1/BRCA2-containing complex, subunit 3
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC002999
Gene Symbol BRCC3
Gene ID (NCBI) 79184
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP46736
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BRCA1-BRCA2-containing complex subunit 3 (BRCC3), a Lys-63-specific deubiquitinase, is a member of the JAMM/MPN family of zinc metalloproteases. BRCC3 have been shown to promote the inflammasome activation by deubiquitinating NOD-like receptor containing pyrin domain 3 (NLRP3). BRCC3 is associated with G2/M arrest in breast cancer cells and DNA damage. The expression of BRCC3 is associated with increased cell proliferation. (PMID: 23246432, PMID: 30272359)

Protocols

Product Specific Protocols
WB protocol for BRCC3 antibody 85430-4-RRDownload protocol
IHC protocol for BRCC3 antibody 85430-4-RRDownload protocol
IP protocol for BRCC3 antibody 85430-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...